Protein Info for Dshi_2898 in Dinoroseobacter shibae DFL-12

Annotation: PUCC protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 141 to 169 (29 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details amino acids 392 to 416 (25 residues), see Phobius details amino acids 436 to 458 (23 residues), see Phobius details PF03209: PUCC" amino acids 56 to 457 (402 residues), 482.2 bits, see alignment E=1.4e-148 PF07690: MFS_1" amino acids 119 to 409 (291 residues), 62.2 bits, see alignment E=4.4e-21

Best Hits

Swiss-Prot: 63% identical to PUCC_RHOSU: Protein PucC (pucC) from Rhodovulum sulfidophilum

KEGG orthology group: K08226, MFS transporter, BCD family, chlorophyll transporter (inferred from 100% identity to dsh:Dshi_2898)

Predicted SEED Role

"Protein pucC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJM8 at UniProt or InterPro

Protein Sequence (467 amino acids)

>Dshi_2898 PUCC protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MSFNLKALALQRIATLGPRYLPFADVATPEVPLSRLLRLSLFQVTVGMALVLLVGTLNRV
MIVELDVPATLVAGMLALPLLFAPFRTLIGHRSDAHVSALGWRRVPYIWKGTLYQFGGFA
IMPFALLVLSGYGESGDLPRWIGMAAAGLAFLLVGAGLHMVQTVGLALATDLVPDEDHPK
VVGLMYVMLLFGMVASALVYGLLLENYTPGRLVQVIQGSAVVTVALNLTAMWKQEARNRD
RAAAQKAAPRVTFREAWDRLVAVPGTLRLLVVIGLGTFGFGMADVLLEPYGGQALGLSVA
QTTKLTALLAGGSLIGFAIASRVLSRGLAPDALARVAASIGIPGFAAIIAASQGFGTALF
LTGTLTTGIGAGLFGHATLTAAIQRAPKGQIGLALGAWGAVQATCAGIGVALAGILRDVL
VNLPGEEGLGVHTPYNVVFGIEILFLALAVLVALPLGARLVRRAIQS