Protein Info for Dshi_2884 in Dinoroseobacter shibae DFL-12

Annotation: 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 PF00364: Biotin_lipoyl" amino acids 4 to 76 (73 residues), 78.3 bits, see alignment E=4.9e-26 amino acids 105 to 177 (73 residues), 77.4 bits, see alignment E=8.9e-26 TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex" amino acids 104 to 495 (392 residues), 560.1 bits, see alignment E=3.5e-172 PF02817: E3_binding" amino acids 207 to 238 (32 residues), 36.3 bits, see alignment (E = 8.1e-13) PF00198: 2-oxoacid_dh" amino acids 266 to 494 (229 residues), 287.3 bits, see alignment E=1.3e-89

Best Hits

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 100% identity to dsh:Dshi_2884)

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJL4 at UniProt or InterPro

Protein Sequence (496 amino acids)

>Dshi_2884 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MSVEVRVPTLGESVTEATVATWFKKPGDTVAVDEMLCELETDKVTVEVPSPAAGTLAEIV
AAEGSTVGVDALLASIGEGSGAAAAEAAPAAPKAAPAESGGESVDVMVPTLGESVTEATV
STWFKKVGDTVVQDEMLCELETDKVSVEVPAPAAGVLTEILAPEGATVEASAKLAVLGGA
GAVAAPSEPAPAPAAPTAQGKDVEDAPSAKKLMAENNLASGDVQGTGRDGRVMKGDVLAA
LAAPKAAAPAPSAAPRAPVAAEDAAREERVKMTKLRQTIAKRLKDSQNTAAMLTTYNEVD
MTETMALRKEYKDLFEKKHGVRLGFMSFFTKACCHALKEVPEVNAEIDGTDIVYKNFVHM
GIAAGTPQGLVVPVIRDADRMSFAEIEAAIAEKGRRARDGKLSMAEMQGGTFTISNGGVY
GSLMSSPILNPPQSGILGMHKIQDRPMVINGEIKIRPMMYLALSYDHRIVDGKGAVTFLV
RVKEALEDPRRLLMDL