Protein Info for Dshi_2842 in Dinoroseobacter shibae DFL-12

Annotation: basic membrane lipoprotein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02608: Bmp" amino acids 29 to 318 (290 residues), 198 bits, see alignment E=9.3e-63

Best Hits

KEGG orthology group: K07335, basic membrane protein A and related proteins (inferred from 100% identity to dsh:Dshi_2842)

Predicted SEED Role

"Predicted nucleoside ABC transporter, substrate-binding component" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJ80 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Dshi_2842 basic membrane lipoprotein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTILQKLLGATGALALSTGAALAEPALIFDLGGKFDKSFNEAAFNGAQRWVQETGGTYRE
IELTSEAQREQALRRFAEAGNNPIVMTGFAFGNVLGEVAPDYPDTSFAIIDMVVDQPNVR
SVVFNEHEGSYLVGMMAAMASETGTVGFIGGMDIPLIRKFACGYAQGVKAANPDATVIQN
MTGTTPAAWNDPVKGGELTRAQISQGADVVYAAAGGTGVGVLQTAADEDILSIGVDSNQN
YLHPGEVLTSMMKRVDNAVFAAMSDGPGFETGIRVLGLAEDGVGYALDEFNAELVTDEMQ
AAVEEAKAKIIAGEITVHDYMSDNTCPVM