Protein Info for Dshi_2809 in Dinoroseobacter shibae DFL-12

Annotation: cytochrome c biogenesis protein transmembrane region (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 134 to 159 (26 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details PF02683: DsbD" amino acids 12 to 224 (213 residues), 193.9 bits, see alignment E=1.7e-61

Best Hits

Swiss-Prot: 36% identical to CCDA_BACHD: Cytochrome c-type biogenesis protein CcdA (ccdA) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K06196, cytochrome c-type biogenesis protein (inferred from 100% identity to dsh:Dshi_2809)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJ47 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Dshi_2809 cytochrome c biogenesis protein transmembrane region (RefSeq) (Dinoroseobacter shibae DFL-12)
MFDVSILGAGFAGLLSFLSPCILPIVPFYLSYMAGVGMNQLEQDTEITPAIRTRAVLSAL
AFSAGVITIFVAMGAGASAFGQVLGQYMDVLRWVAAALIATMGLHFLGVIRIGFLYRQFR
MEAGSTTNMSFLGAYLIGLAFAFGWTPCVGPVLAAILFTVATEGTGMTRGMLLLTVYGVG
MTLPFVLAALFIGPFLRWMRGFRRHLGRIEKATGVFLVLFAVLIGTNSMNIIANWMLNYL
PALG