Protein Info for Dshi_2770 in Dinoroseobacter shibae DFL-12

Annotation: magnesium transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 297 to 317 (21 residues), see Phobius details amino acids 323 to 348 (26 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details amino acids 399 to 424 (26 residues), see Phobius details amino acids 433 to 458 (26 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 36 to 459 (424 residues), 313.4 bits, see alignment E=1.2e-97 PF03448: MgtE_N" amino acids 45 to 145 (101 residues), 77.5 bits, see alignment E=1.5e-25 PF00571: CBS" amino acids 222 to 266 (45 residues), 26.4 bits, see alignment 1.1e-09 PF01769: MgtE" amino acids 331 to 454 (124 residues), 119.1 bits, see alignment E=2.2e-38

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to dsh:Dshi_2770)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJ08 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Dshi_2770 magnesium transporter (RefSeq) (Dinoroseobacter shibae DFL-12)
MADSQELVEDTADEDYALRRDVVETLFDALDAEDPARVAEVLEPLHPADIADLFEQIGGS
RLRALLAIWTSDEIGAVLSELDEGLREDVIDALPQAVLADAVRDLDSDDVVDLVEDLDAA
QQTAILDVLEAPDRVAVEQSLQYPEYSAGRLMQRELVKAPEHWTVGETIDHIRAEDDLPE
QFYHVILIDPRMRPTGYVTLGRIMGAHRDVPLQDLTEDSFRKIPVTQPESEVAYAFNQYH
LISAPVVDENERLVGVITIDDAMVVLDEEHNEDILRLAGVGDESVSDSTWEITRQRFPWL
GVNLATAIIASLVISLFEEVLTQVVALAVLMPIVASMGGNAGTQSLTVAVRAIATKDLTG
SNAWRVLRREVTASLLNGAVFAVIMGAVSLVWFGTPVLAGLIAVAMVINLGVAGFAGLLI
PLALDKLKIDPALASGTFVTTVTDVVGFFVFLGLASMILL