Protein Info for Dshi_2760 in Dinoroseobacter shibae DFL-12

Annotation: phosphoglycolate phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00702: Hydrolase" amino acids 3 to 179 (177 residues), 106.3 bits, see alignment E=5.6e-34 PF13419: HAD_2" amino acids 6 to 186 (181 residues), 113.9 bits, see alignment E=1.8e-36 PF12710: HAD" amino acids 6 to 177 (172 residues), 51.4 bits, see alignment E=3.6e-17 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 6 to 201 (196 residues), 194 bits, see alignment E=3.5e-61 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 83 to 179 (97 residues), 30.5 bits, see alignment E=6.5e-11 PF13242: Hydrolase_like" amino acids 143 to 193 (51 residues), 28.3 bits, see alignment E=2.7e-10

Best Hits

Swiss-Prot: 43% identical to GPH_RHORT: Phosphoglycolate phosphatase (cbbZ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to dsh:Dshi_2760)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIZ8 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Dshi_2760 phosphoglycolate phosphatase (RefSeq) (Dinoroseobacter shibae DFL-12)
MRYDAVVFDLDGTLVDSAPDMARAINGVLATRGRRALSLAEVISFIGSGARILVQRSLRA
TGGIEGEDDALAEFLRRYETGVDHETAVYTGVMEMLGALRAAGLPMALCTNKPEAPARDL
SARLGLGGFFPVIVGGDTLPVLKPDPAPLHHAITGLSADPARTLYVGDSETDYKTARAAQ
VDFAFVEGGYQSRPIPDFAPTHRLARPALVGDLVLSGVVTR