Protein Info for Dshi_2735 in Dinoroseobacter shibae DFL-12

Annotation: HflC protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details amino acids 25 to 25 (1 residues), see Phobius details transmembrane" amino acids 23 to 24 (2 residues), see Phobius details PF01145: Band_7" amino acids 23 to 202 (180 residues), 98.5 bits, see alignment E=2.4e-32

Best Hits

Swiss-Prot: 32% identical to HFLC_HAEIN: Protein HflC (hflC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04087, membrane protease subunit HflC [EC: 3.4.-.-] (inferred from 100% identity to dsh:Dshi_2735)

Predicted SEED Role

"HflC protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIM7 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Dshi_2735 HflC protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MKKGPIGLIALAVVGFVAINSVFIVDEREKALVLQFGQIKAVKEEPGLAFKIPFIQEVVR
YDDRILSLDTQQIEVTPSDDRRLVVDAFARYRIADVVQFRQAVGVGGMRAAEQRLEGILN
PQIRAVLGSDGVTSNTILSADRGTLAARITAGVRSRAADIGLEVVDVRLKQTNLPTQNLD
ATFARMRAEREREAADEIARGEEAAQRVRAQADRTVVELVSESQKEADITRGEADARRNA
IFAAAFGADPDFFEFYRSMTAYERALQGNNSTMVIAPDSEFFDYLDGSDAVSGRPVP