Protein Info for Dshi_2687 in Dinoroseobacter shibae DFL-12

Annotation: pseudoazurin (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR02375: pseudoazurin" amino acids 33 to 153 (121 residues), 117.8 bits, see alignment E=1.1e-38 PF00127: Copper-bind" amino acids 44 to 122 (79 residues), 54.2 bits, see alignment E=8e-19

Best Hits

Swiss-Prot: 50% identical to AZUP_ACHCY: Pseudoazurin (bcp) from Achromobacter cycloclastes

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2687)

Predicted SEED Role

"Pseudoazurin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LIH9 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Dshi_2687 pseudoazurin (RefSeq) (Dinoroseobacter shibae DFL-12)
MTSRMTRRFFLASTAAVSVARPALAQSQTVVEMLNKDPDNPRLRMVFSPRIVVVQPGDTV
KFAATDPSHNSASIDGMLPEGAEAWNGKINEEIVVPFPTPGFYGYKCTPHAATGMVGLVI
VEGAGMMANLEAAQGVKQRGRAAKVWEEIWAEVAEMEFATS