Protein Info for Dshi_2569 in Dinoroseobacter shibae DFL-12

Annotation: putative ammonia monooxygenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 302 to 333 (32 residues), see Phobius details TIGR03082: membrane protein AbrB duplication" amino acids 7 to 157 (151 residues), 97.8 bits, see alignment E=2.8e-32 PF05145: AbrB" amino acids 27 to 336 (310 residues), 274.7 bits, see alignment E=4.4e-86

Best Hits

KEGG orthology group: K07120, (no description) (inferred from 100% identity to dsh:Dshi_2569)

Predicted SEED Role

"Bll1341 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LSV3 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Dshi_2569 putative ammonia monooxygenase (RefSeq) (Dinoroseobacter shibae DFL-12)
MIGIFTAFAVALAGVGLFQWLDLPLPWLLGPIFACLTAAMLGVPMRSLKPINEATRMVLG
VAVGATLTPPVLATFPAMWPTLMLVPVMVVAIGLVGVPYFRRLWGYDPATAYYSAMPGGL
QDMLLFGEEAGGNVRTLSLIHATRVTVIVVALPFLLKGVWGADLGNPPGASLGVVPVHEM
GLMGLCAIVGWWGARRIGLFGAAILGPMIVTGAAAMSGLLENRPPAEAIWAAQFFIGVTI
GCKYVGITWGEIRRDLAAGLGFCGILIVLTLIFVEGVYLAGLAPGMETLLAFAPGGQAEL
TVLALIVGADVAFVVAHHILRIFVVILGAPIVVRMLGDKDAR