Protein Info for Dshi_2546 in Dinoroseobacter shibae DFL-12

Annotation: Malate/L-lactate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF02615: Ldh_2" amino acids 6 to 337 (332 residues), 367.1 bits, see alignment E=4.2e-114

Best Hits

Swiss-Prot: 37% identical to YJMC_BACSU: Uncharacterized oxidoreductase YjmC (yjmC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2546)

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LST0 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Dshi_2546 Malate/L-lactate dehydrogenase (RefSeq) (Dinoroseobacter shibae DFL-12)
MPDDTISAEALQDFVARALSARGVPTQDANKVAGLMVEADIYGYGTHGVFRLRQYLARLE
GGGCNPAPNISVLQQTVATALIDGDNGFGHLAMAAARDLAMEKARQAGIGWVGVRRGNHA
GPLALYVRPQAEAGLLGMAAAVGSANHVPPYGGTDLLLGTNPIAFSAPAEGPDPFVFDMA
TTVAAMGKIKTLLQQGADMPEGWMVGRDGKPLTDPARKSEGFLLPIGGPKGFGLSVAIGL
MAGVLNGAAFGSDVVDFTSDTTSPTNTGQFVMALDPAAFGLGDGFAETARRVFGEMRASP
PLPGHHPVRLPGDGKTQAAETRRRQGLTLNPALRKDLDALAEKYGVEPVSS