Protein Info for Dshi_2488 in Dinoroseobacter shibae DFL-12

Annotation: transcriptional regulator, XRE family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF13560: HTH_31" amino acids 6 to 59 (54 residues), 41 bits, see alignment 5e-14 PF13443: HTH_26" amino acids 8 to 64 (57 residues), 24.9 bits, see alignment 4.8e-09 PF01381: HTH_3" amino acids 9 to 62 (54 residues), 44.4 bits, see alignment 3.3e-15 PF06114: Peptidase_M78" amino acids 186 to 308 (123 residues), 68.3 bits, see alignment E=1.4e-22 PF09856: ScfRs" amino acids 310 to 465 (156 residues), 188.5 bits, see alignment E=1.8e-59

Best Hits

KEGG orthology group: K07110, (no description) (inferred from 100% identity to dsh:Dshi_2488)

Predicted SEED Role

"Transcriptional regulator, XRE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LSM3 at UniProt or InterPro

Protein Sequence (467 amino acids)

>Dshi_2488 transcriptional regulator, XRE family (RefSeq) (Dinoroseobacter shibae DFL-12)
MKTFIGPRLRRLRRDANQTQAEMAKALGISNSYVNMLEKNERSVSVPVLLRLFEAYGVDW
RDIADEDDTATLNALRAAFQDPLFHDHSPDLPQLRALLSHAPDVARSFLQLHHAYRAATD
QLLVLSNASETDLDILRASPEAIVHDFFRDNRNHFPELEAAAQEFWAGPMPEADDIYGAL
KARLKDKLGLRTRIVPVGDMPEALREYDEDRREVRLSEGLDHPNRAFQLAHTSGLIEQSA
VIDALLSRLDLDDPSGRNRCRVELANYFAAAVLMPYDAFRAEALACKYDFAHLSLRFGVS
FEQACHRATTLQRDGAEGVPFFFLRIDKAGNVTKRFNSTGFHLAEYGGACPRLDLHTSFR
SPGSIVPQFVEMPDGGRFFVFARTVNRPRFSRHTQDKRLAIAMGCSIEHVAAIGYAEDIQ
QGSPRFAEVGINCRICPRANCDQRAHNAMILNEPVDVRRRGPTRYAN