Protein Info for Dshi_2418 in Dinoroseobacter shibae DFL-12
Annotation: cell division protein FtsQ (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to FTSQ_DINSH: Cell division protein FtsQ (ftsQ) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
KEGG orthology group: K03589, cell division protein FtsQ (inferred from 100% identity to dsh:Dshi_2418)Predicted SEED Role
"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LS59 at UniProt or InterPro
Protein Sequence (297 amino acids)
>Dshi_2418 cell division protein FtsQ (RefSeq) (Dinoroseobacter shibae DFL-12) MRPLSFRRRTAQARPDPAPSRLSYRVQRLLLTPLFHALIRVGLPAFVLAFGVGWLLQNQE LRDELVAQTIALRTQIEQRPEFMVNAMSVSGASTELIEDIHEVVPIDFPVSSFALDLEAM DRIIGELDAVAEVDLSIQAAGILAIEIVERTPAVVWQTRQTLEILDAEGHRVGPIESRAA HAALPLVAGPGGNRAVAEALRLLEVAEELAPRIIGLQRMGERRWDVVLTEGQRILLPERE AELALARVIELDQAEDLFARDISVVDMRLPDRPTVRLNPDALDALWTIRGLTNDRIE