Protein Info for Dshi_2379 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF140 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details PF02405: MlaE" amino acids 45 to 253 (209 residues), 233.8 bits, see alignment E=8.2e-74

Best Hits

Swiss-Prot: 52% identical to Y1340_RICBR: Probable ABC transporter permease protein RBE_1340 (RBE_1340) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to dsh:Dshi_2379)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRT4 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Dshi_2379 protein of unknown function DUF140 (RefSeq) (Dinoroseobacter shibae DFL-12)
MIRLIAAIGASVLGILGAAGRFAIFVGAAFSHMVRPPFYWREFGQALLNIGYFSLPVVGL
TAFFTGGALALQIYAGGARFSAEAVVPQIVAIGMVRELGPVLGGLMIAARVTSSIAAEIA
TMKVTEQIDALVTLSTHPMKYLTAPRVLAAILVVPLLVAVGDTIGIMGGYLVSTSRLGFN
PATYLQNTVDFLELHDIVSSLAKGAVFGAIAALMGCYSGMNSGRGAQGVGAATKSSVVAA
AVLILAANYMLTELFFSG