Protein Info for Dshi_2369 in Dinoroseobacter shibae DFL-12

Annotation: urease, gamma subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00193: urease, gamma subunit" amino acids 1 to 100 (100 residues), 145.4 bits, see alignment E=2.7e-47 PF00547: Urease_gamma" amino acids 1 to 99 (99 residues), 152.9 bits, see alignment E=1.4e-49

Best Hits

Swiss-Prot: 100% identical to URE3_DINSH: Urease subunit gamma (ureA) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K01430, urease subunit gamma [EC: 3.5.1.5] (inferred from 100% identity to dsh:Dshi_2369)

MetaCyc: 83% identical to urease gamma subunit (Sinorhizobium meliloti Rm2011)
Urease. [EC: 3.5.1.5]

Predicted SEED Role

"Urease gamma subunit (EC 3.5.1.5)" in subsystem Urea decomposition (EC 3.5.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.5

Use Curated BLAST to search for 3.5.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRS4 at UniProt or InterPro

Protein Sequence (100 amino acids)

>Dshi_2369 urease, gamma subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MNLTPREKDKLLVSLAAIVARGRLERGVKLNHPEAIALITDYVVEGARDGRSVADLMQAG
AQVVRAEQCMPGIPEMIHDVQVEATFPDGTKLVTVHHPIR