Protein Info for Dshi_2363 in Dinoroseobacter shibae DFL-12

Annotation: UreE urease accessory domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF02814: UreE_N" amino acids 13 to 51 (39 residues), 35.2 bits, see alignment E=7.2e-13 PF05194: UreE_C" amino acids 79 to 155 (77 residues), 109.3 bits, see alignment E=9.3e-36

Best Hits

Swiss-Prot: 60% identical to UREE_RHOCA: Urease accessory protein UreE (ureE) from Rhodobacter capsulatus

KEGG orthology group: K03187, urease accessory protein (inferred from 100% identity to dsh:Dshi_2363)

Predicted SEED Role

"Urease accessory protein UreE" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRR8 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Dshi_2363 UreE urease accessory domain protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MSLPRITRLGKAHGATDTLSLDYEARFLRRKRLVSDGGRAFLLDLPEVVSLGPEHGIDLP
DGTRIAVRAAPEALLAVKGDLTRLAWHIGNRHTPCQITPDALYIRHDHVLADMLRQLGAE
VAQVTAPFTPEGGAYGHGRTMGHEHGHGHGHDHAHGASDD