Protein Info for Dshi_2354 in Dinoroseobacter shibae DFL-12

Annotation: major facilitator superfamily MFS_1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 5 to 26 (22 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 200 to 224 (25 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 346 to 371 (26 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 322 (315 residues), 132.4 bits, see alignment E=9.7e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2354)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRQ9 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Dshi_2354 major facilitator superfamily MFS_1 (RefSeq) (Dinoroseobacter shibae DFL-12)
MDARLYYLTLGNVMIGTGTMVVSGILDPIAADLAISVSAAGQVTTVYALAFALGAPVAAA
FTGRFDRSRVLALSLLVFAAASLLSAVAPNYTTLLIARGLGGLAAATFSPTAVAVAASLV
PPAERGRAIALVFGGMTIASVLGVPLGTWIGLNFGWRILLAGLGVLSLGAVIALWRGVPG
GLFLPAATLARWDEALRLPIIRALLGVTLFQIGGSFVLFAFFGPYLGTVTGVGTDGIASL
LFLFGLASLIGNFAAGWAVDRVGAGPVAHGAIALTALSMVALLGTAGAPVLAGLAIILWG
SAVFGINTAQQARLVDAAPGLATVVLPANSSILFAGQALGAALGGAVLAMGGLAALPLVG
ALVVGIALVLSLRAMRQTGRAPV