Protein Info for Dshi_2342 in Dinoroseobacter shibae DFL-12

Annotation: TRAP-type mannitol/chloroaromatic compound transport system small permease component-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 60 to 86 (27 residues), see Phobius details amino acids 104 to 132 (29 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details PF04290: DctQ" amino acids 142 to 216 (75 residues), 36.3 bits, see alignment E=2.5e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2342)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, small permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRP7 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Dshi_2342 TRAP-type mannitol/chloroaromatic compound transport system small permease component-like protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MESEAQVSALASIAGGVWWVLQNIGLAFYNTAWAILNPGQWLGWIGGLETTEDKEALMRF
AYYGASVEFFFFLLTAFLVALAIGIARPRAMWGMVIGLEGFANVVGRVAAWAGLLMVVQQ
ILIVMLQRFFLVSQISIGPFGYTFTKDLSWFGEELKLYNAIVVCLCCAYTFVQGGHVRVD
LVYSVVKHRTKKVIDMAGSLLFMMPAMVLIWLYSWFFMWRHLITPKISASDPFDRMMLKA
RAVRWNVETVGFSPQGFDGYFLFKILICLFVAMVFLQAVAFFFRSFQEWREGEESAGKYH
DKDALGDEDAERVAEIH