Protein Info for Dshi_2287 in Dinoroseobacter shibae DFL-12

Annotation: TRAP transporter, 4TM/12TM fusion protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 43 to 59 (17 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 216 to 242 (27 residues), see Phobius details amino acids 277 to 305 (29 residues), see Phobius details amino acids 339 to 357 (19 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details amino acids 392 to 418 (27 residues), see Phobius details amino acids 438 to 457 (20 residues), see Phobius details amino acids 463 to 484 (22 residues), see Phobius details amino acids 489 to 514 (26 residues), see Phobius details amino acids 525 to 551 (27 residues), see Phobius details amino acids 560 to 581 (22 residues), see Phobius details amino acids 594 to 620 (27 residues), see Phobius details TIGR02123: TRAP transporter, 4TM/12TM fusion protein" amino acids 28 to 619 (592 residues), 424.6 bits, see alignment E=3.9e-131 PF06808: DctM" amino acids 113 to 548 (436 residues), 220.7 bits, see alignment E=1.6e-69

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2287)

Predicted SEED Role

"TRAP-type uncharacterized transport system, fused permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LRA0 at UniProt or InterPro

Protein Sequence (639 amino acids)

>Dshi_2287 TRAP transporter, 4TM/12TM fusion protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MNQPATIPVANPAPAGGLGAPLGGLFALLVICVIAFATLDEATARFGAIALSVAIVGLAH
PARRGRPSGRAVDAALLAGFGCAGWWFHAVKAELWTGFFVATPLSVLAGLAGVFTVIVLA
ARVWGRSLAILAGALILYAFGGPYLPNAVAHFGVGLGDFVQITWYSFDGVFGRMTGLVAS
NLLIFLILGAVLQQTGAGESLIRLSTALLGRVRGGGAHAAIAASAVFGMMNGSVAANIAG
TGVFTIPMIKRQGFSSRFAGAVEAAASSGGQLTPPIMAATVFVMADLVGLPLLMVIAAAA
LPALFKYLGLFAQVYVEALRLDIRPLAAEDIPKLTRQDWLQSALVLVPLAVLMIAFLSGS
SPAMAGLAGTIAALVTGLVLTPQLRQQPIRIWWALCAGGLASARILLSVAVIGIVLAVVN
ETGIAIRFAVALSEVGDAYLPLALLMAMLGALVLGMGLPTLPAYLIVAIMIVPTLIEAGV
LPLAAHMFVLYFAVFSSIMPPIAYGCFVAAPIAGADALRISFTALRISIVGLIVPFAFVY
APSLLLVAGSFSWAELLTTALRLSLASWLLATALGGADPVLGRLPRHNRMLRGGAACAVM
VPTVALWGPGLALGIAMGVLHPLHRAGWIKRVSLRAHGT