Protein Info for Dshi_2262 in Dinoroseobacter shibae DFL-12

Annotation: DNA primase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 TIGR01391: DNA primase" amino acids 5 to 422 (418 residues), 397.2 bits, see alignment E=4.1e-123 PF01807: Zn_ribbon_DnaG" amino acids 7 to 102 (96 residues), 87.2 bits, see alignment E=1.7e-28 PF08275: DNAG_N" amino acids 127 to 255 (129 residues), 142.4 bits, see alignment E=2.5e-45 PF13662: Toprim_4" amino acids 265 to 327 (63 residues), 53.5 bits, see alignment E=7e-18 PF01751: Toprim" amino acids 265 to 341 (77 residues), 37.8 bits, see alignment E=5.3e-13 PF13155: Toprim_2" amino acids 266 to 354 (89 residues), 48.8 bits, see alignment E=2.3e-16 PF10410: DnaB_bind" amino acids 376 to 423 (48 residues), 21.7 bits, see alignment 5.8e-08

Best Hits

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 100% identity to dsh:Dshi_2262)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LR75 at UniProt or InterPro

Protein Sequence (650 amino acids)

>Dshi_2262 DNA primase (RefSeq) (Dinoroseobacter shibae DFL-12)
MSLPPGFLDELRSRVSMAQVAGRKLIWDMRKSQQGKGDMWAPCPFHQEKTASFHVDDRKG
YYYCFGCHAKGDAISFVRETENVGFMEAVEILAAEAGMPMPARDPQAAAKADRRTQLSEV
AEQAVQFFRLNLKTAAAAEARAYLVRRGLSEEAQARWEIGFAPDGWQHLWDHLRGKGVAE
DLILDAGLAKPSRKEGGRPYDVFRNRIMFPIRDARGRAIAFGGRAMDPEDGAKYLNSPET
ELFDKSRVLFNHARAREAAGKSSPLIVAEGYMDVIALSEAGFAGAVAPLGTAVTEPQLEL
LWRISPEPVFALDGDRAGLQAGQRVVDLALPLITAGKSMRFCILPEKQDPDDVIRAGGAE
AMATLLDQAKPMVELLWQRETAGKVFDSPERKAALGKALRQAVAKITDPTIKQHYGQEVK
TRLDALFGYGPSKGRSGPAGPWRKRGQEGPTQTTRSSALVTADRDDLLQESVILATLCAH
PGLIAEFESDLLDHRFGTEAFARMAARLASMMPDPDAPEISLEGTSCAQTLEAILSERHV
TISPSLRPGCDPEVARMTVAEGFAKLAARTGWQREMEDAIEDFASVADEDLTWRLGQAAE
AREAAGRISQTDTTEYDIADNGARISRDERNALDNLLNGISFAKGRSNGG