Protein Info for Dshi_2250 in Dinoroseobacter shibae DFL-12

Annotation: 6,7-dimethyl-8-ribityllumazine synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase
  • amino acids 19 to 150 (132 residues), 90.9 bits, E=3.8e-30
• PF00885: DMRL_synthase
  • amino acids 19 to 152 (134 residues), 132.8 bits, E=4.2e-43

Best Hits

Swiss-Prot: 60% identical to RISB_JANSC: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Jannaschia sp. (strain CCS1)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 100% identity to dsh:Dshi_2250)

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

See A8LR63 at UniProt or InterPro

Protein Sequence (183 amino acids)

>Dshi_2250 6,7-dimethyl-8-ribityllumazine synthase (RefSeq) (Dinoroseobacter shibae DFL-12)
MAQAETHHELPLPRFEKPVKVLIVQSPYYKDIADGLLTGAKAVLEAAGASFEVVHVPGAL
EIPPAIRIAHVQSNFDGYVALGCVIRGETSHYETVCNDSSHGLMLLGLQGACLGNGILTV
ENKDQALVRADPEGQNKGGGAAAAALHLIALSRRYATQTKGVGFKPRGETIQLADGGESP
SRA