Protein Info for Dshi_2239 in Dinoroseobacter shibae DFL-12

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 221 to 242 (22 residues), see Phobius details PF23441: SDR" amino acids 14 to 246 (233 residues), 30 bits, see alignment E=8.9e-11 PF00106: adh_short" amino acids 14 to 199 (186 residues), 164.1 bits, see alignment E=7.3e-52 PF01370: Epimerase" amino acids 15 to 176 (162 residues), 28.5 bits, see alignment E=2.5e-10 PF08659: KR" amino acids 16 to 171 (156 residues), 44 bits, see alignment E=6e-15 PF13561: adh_short_C2" amino acids 19 to 248 (230 residues), 196.9 bits, see alignment E=1e-61

Best Hits

Swiss-Prot: 41% identical to DCXR_BOVIN: L-xylulose reductase (DCXR) from Bos taurus

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2239)

MetaCyc: 41% identical to D-gluconate 5-dehydrogenase monomer (Gluconobacter oxydans 621H)
1.1.1.-

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LR52 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Dshi_2239 short-chain dehydrogenase/reductase SDR (RefSeq) (Dinoroseobacter shibae DFL-12)
MLPRTPSFRLDGQRALVTGASRGIGLGCAVALAEAGAHVVMAARGQAELDAAATEMRAEG
WSVETAVLDIADLDAQAEFFGAQAPFDCLVNSAGLARHSPALDTRPEDFDAVMSVNLRAA
YFLATNAARTMPDGGSIVQISSQMGHVGGLDRAVYCASKHGVEGMTKAMAQEFGPRGIRV
NSLCPTFIRTPLTEATFADPEKRAWIMGKIKLPRVAEIEDIMGAVVFLCSPASAMVTGTG
LLVDGGWTSG