Protein Info for Dshi_2203 in Dinoroseobacter shibae DFL-12

Annotation: cytidyltransferase-related domain (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 16 to 192 (177 residues), 112.5 bits, E=1.3e-36
• PF01467: CTP_transf_like
  • amino acids 16 to 192 (177 residues), 66.9 bits, E=1.1e-22

Best Hits

Swiss-Prot: 100% identical to NADD_DINSH: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to dsh:Dshi_2203)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (21/25 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (3/4 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• NAD de novo biosynthesis I (3/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (3/6 steps found)
• NAD salvage (plants) (6/11 steps found)
• NAD de novo biosynthesis II (from tryptophan) (4/9 steps found)
• superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

See A8LR16 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Dshi_2203 cytidyltransferase-related domain (RefSeq) (Dinoroseobacter shibae DFL-12)
MRSGWPMAGTGQTVGLLGGSFDPAHGGHVHITRQALARFGLDWVWWLVSPGNPLKPNPPA
PLALRCARARALMRHPRVRITGIEAELGTRYTAETVAGLRRCYPGVRFVWLMGADNLAQF
HRWDRWDEIMAQVPVGVLARPGQRLAALRAPAAQRFAGARRGAAGLGRAQAPAWAFVNVP
LVDLSSSEIRARGDW