Protein Info for Dshi_2201 in Dinoroseobacter shibae DFL-12

Annotation: Putative protein-S-isoprenylcysteine methyltransferase-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 85 to 101 (17 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details PF06966: DUF1295" amino acids 13 to 143 (131 residues), 28.4 bits, see alignment E=1.7e-10 PF04191: PEMT" amino acids 44 to 134 (91 residues), 52.7 bits, see alignment E=8e-18 PF04140: ICMT" amino acids 65 to 128 (64 residues), 27.8 bits, see alignment E=4.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2201)

Predicted SEED Role

"Putative protein-S-isoprenylcysteine methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LR14 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Dshi_2201 Putative protein-S-isoprenylcysteine methyltransferase-like protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTRLIPPILVLILLSALVPLRVLHPETLVMRANAAMPWDVPLSLGLVVLAWAFWHFKRRD
AEIHTFRQPKVMVTDGPFRYSRNPMYLGFFLLLLAAAFYVNTWCALLAPLAFLLTAIFWY
IPHEEKRMRDTFGSAYDDYAWTTRRWI