Protein Info for Dshi_2128 in Dinoroseobacter shibae DFL-12

Annotation: Paraquat-inducible protein A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 49 (4 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details PF04403: PqiA" amino acids 6 to 137 (132 residues), 51 bits, see alignment E=7.8e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2128)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQJ7 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Dshi_2128 Paraquat-inducible protein A (RefSeq) (Dinoroseobacter shibae DFL-12)
MNARVLAWANLSLLVLFPIAWTAPLLRAGLLPIFGLAEISVLSGVASLWDSAPALAALVA
VLAILAPYAKTLTLAAVQFGLLAKKPVWLIWLGRLAMADVFLIALYVVIVKGVGLARVEV
AWGLGLFTACVLASLLFSYLAERPGGLTTAAGSGKRQDPHGP