Protein Info for Dshi_5008 in Dinoroseobacter shibae DFL-12

Annotation: L-serine dehydratase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00720: L-serine ammonia-lyase
  • amino acids 4 to 467 (464 residues), 586.7 bits, E=1.6e-180
• PF03315: SDH_beta
  • amino acids 4 to 161 (158 residues), 180.7 bits, E=2.5e-57
• PF03313: SDH_alpha
  • amino acids 201 to 464 (264 residues), 274 bits, E=1.6e-85

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_5008)

Predicted SEED Role

"L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• glycine betaine degradation I (7/8 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• glycine betaine degradation III (4/7 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

See C5ZZE3 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Dshi_5008 L-serine dehydratase (NCBI) (Dinoroseobacter shibae DFL-12)
MFLSVFDIFKVGVGPSSSHTMGPMTAAARFLDDLRGGAERIPGAGKLARLGASLHGSLAF
TGKGHATDRAVILGLIGYLPDTLDPDAAEKLEAEVRGTKRISPPGLGTLAFDPETDLVFD
YGPPLPGHANGLVLNAYDEQGNLYMTQTYYSVGGGFVVTEAELEREKSAASNDLHDEKAA
MGYPYPFGSAAEMLAMGQASGLSIAQMKRANEEAHSGPGLNKRIDAVCAVMDACIDRGLR
MDGILPGGLKVKRRAKAIHEQLLAERGQNQSQPHVANDWLSVYAMAVNEENAAGGRVVTS
PTNGAAGVVPAVIRYYRDHCIGATAEGVRTFMLTASAIGGLIKHNASISGAEMGCQGEVG
SASAMAAAGFCAAMGGTNAQIENAAEIALEHHLGMTCDPAAGLVQVPCIERNGLGAIKAV
SAASLALRGDGTHFMPLDNCIETMRQTGHDMLTKYKETSLGGLAVNLPEC