Protein Info for Dshi_5008 in Dinoroseobacter shibae DFL-12

Annotation: L-serine dehydratase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 TIGR00720: L-serine ammonia-lyase" amino acids 4 to 467 (464 residues), 586.7 bits, see alignment E=1.6e-180 PF03315: SDH_beta" amino acids 4 to 161 (158 residues), 180.7 bits, see alignment E=2.5e-57 PF03313: SDH_alpha" amino acids 201 to 464 (264 residues), 274 bits, see alignment E=1.6e-85

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_5008)

Predicted SEED Role

"L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C5ZZE3 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Dshi_5008 L-serine dehydratase (NCBI) (Dinoroseobacter shibae DFL-12)
MFLSVFDIFKVGVGPSSSHTMGPMTAAARFLDDLRGGAERIPGAGKLARLGASLHGSLAF
TGKGHATDRAVILGLIGYLPDTLDPDAAEKLEAEVRGTKRISPPGLGTLAFDPETDLVFD
YGPPLPGHANGLVLNAYDEQGNLYMTQTYYSVGGGFVVTEAELEREKSAASNDLHDEKAA
MGYPYPFGSAAEMLAMGQASGLSIAQMKRANEEAHSGPGLNKRIDAVCAVMDACIDRGLR
MDGILPGGLKVKRRAKAIHEQLLAERGQNQSQPHVANDWLSVYAMAVNEENAAGGRVVTS
PTNGAAGVVPAVIRYYRDHCIGATAEGVRTFMLTASAIGGLIKHNASISGAEMGCQGEVG
SASAMAAAGFCAAMGGTNAQIENAAEIALEHHLGMTCDPAAGLVQVPCIERNGLGAIKAV
SAASLALRGDGTHFMPLDNCIETMRQTGHDMLTKYKETSLGGLAVNLPEC