Protein Info for Dshi_2108 in Dinoroseobacter shibae DFL-12

Annotation: cyclic nucleotide-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 835 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 242 to 271 (30 residues), see Phobius details amino acids 291 to 308 (18 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 392 to 418 (27 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 15 to 415 (401 residues), 156.2 bits, see alignment E=1.2e-49 PF00027: cNMP_binding" amino acids 727 to 807 (81 residues), 51 bits, see alignment E=1.2e-17

Best Hits

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 100% identity to dsh:Dshi_2108)

Predicted SEED Role

"putative sodium/hydrogen exchanger family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQH8 at UniProt or InterPro

Protein Sequence (835 amino acids)

>Dshi_2108 cyclic nucleotide-binding protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MDIVIVSAVIASLFLVIGAAEPLAARLRLPFTVILAVLGILIGSGAIFFLRTDLTDALNP
VAEAILGLPISSNVFLYVFLPTLLFQATLGMNLRRMLDDWVPIMVLAVVAVVVATLSVGY
ALSWASTLPLVACLLIGAIVSTTDPSAVVSIFRSISAPRRLSRIIEGESLLNDAAAIALF
GLFMGFVMMGVPDPRLGEALGQFPILIAGGALTGWLAAQVAVWIMAMFRAHELAMISVSV
ALPYLAYIGSEQVVGASGVIAVVAAGLTLNLTGPGRLPPQAWANLGEVWDLLAHWAGALI
FILAALLIPRLLEGVRLSDFVLLGVVILAALAARAVVLFGLLPLLTLMRVSPHVERPYRT
AILWGGLRGAVTLALALAVTESIWVPGEVKRLVGILATGFTLFTLLVQGTTLRAVIGWLG
LDQLSPIDEAMSRQVIAVSLQTVREDVARTTEDYALTHDVVRAEAKAFGERLEQAVKAAE
DSDDILDRDRITLGLIALAGFERYTILARVRERTISARMAEQTLLDADRLIEGARAGGRN
GYQRAARRSVAYGPGFRVAGLLHRRFGLSRPLVRMTADRFELLLSQRLTLRDLDAFIEGR
IRRIHGRRVADLLLELLARRIEMVETALDGLRLQYPGYAEELERRFIRRTALRLEEREYA
AMREDGLIGAEVFTTLMQDLATRRAQAEHRPPLDIAVQRLELIRQFPLFSDLDDKTLRQL
SRALKTRYVNAGNIALHKNRPVRSVYFIASGAVEVESAGQTWRLGRGEMFGQIAILMKKA
RRAEARAIAPTTLLVLDVARFRALLNRSAALRDAVRASAEKRGLDPNQILASADP