Protein Info for Dshi_2105 in Dinoroseobacter shibae DFL-12

Annotation: DNA methylase N-4/N-6 domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF01555: N6_N4_Mtase" amino acids 162 to 219 (58 residues), 32.1 bits, see alignment E=5.7e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2105)

Predicted SEED Role

"Type III restriction-modification system methylation subunit (EC 2.1.1.72)" in subsystem Restriction-Modification System (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPY8 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Dshi_2105 DNA methylase N-4/N-6 domain protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MSRLTDLIAQAKAKDATLGNELEREFRALANRRAFGLNFERHAPESVELPGRPIRKGDKV
RVLPPRGSTDKGDQRLWKVNRTYKQDGKRVADLTLHEAAEPEAQTVPVEDLIVVAEFRDY
IYPGLVSTGKVERGGDKPYHTVINGENFHALEALTYTHRGKIDVIYIDPPYNSGASDWKY
NNKYVGDEDVYRHSKWLAFMERRLQVARQLLKPSGALTCSPLSPRL