Protein Info for Dshi_2061 in Dinoroseobacter shibae DFL-12

Annotation: aspartate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00656: aspartate kinase, monofunctional class
  • amino acids 1 to 408 (408 residues), 410.5 bits, E=7.9e-127
• PF00696: AA_kinase
  • amino acids 3 to 231 (229 residues), 156.9 bits, E=1.1e-49
• TIGR00657: aspartate kinase
  • amino acids 63 to 407 (345 residues), 377.3 bits, E=1.2e-116
• PF01842: ACT
  • amino acids 269 to 328 (60 residues), 49.2 bits, E=5.2e-17
• PF13840: ACT_7
  • amino acids 341 to 404 (64 residues), 62.3 bits, E=4.9e-21

Best Hits

Swiss-Prot: 54% identical to AK_PSEFS: Aspartate kinase (PFLU_4747) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to dsh:Dshi_2061)

MetaCyc: 44% identical to aspartokinase beta subunit (Corynebacterium glutamicum ATCC 13032)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• aspartate superpathway (21/25 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

See A8LPU4 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Dshi_2061 aspartate kinase (RefSeq) (Dinoroseobacter shibae DFL-12)
MSILVMKFGGTSVADLDKIKNAAEKVQREVARGHKVIVIVSAMSGKTNELVGWVGKTSPL
YDAREYDAVVSSGENVTAGLLALTLQEMEIPARSWQGWQVPLRTNSAHAAARIEEIPRAN
LDAKFDEGMQVAVIAGFQGISPEGRITTLGRGGSDTTAVAFAAAFGAVRCDIYTDVDGVY
TTDPRIEDKARKLDRIAYEEMLELASLGAKVLQTRSVELAMRFKVPLRVLSSFEENTDTS
GTLVCDEDEIMESNVVSGVAYSRDEAKMTLISVADRPGIAAAIFGPLSEAGVNVDMIVQN
ISEDGRTDMTFSCPTDQVLRAERAIKEAKELGEINFQELVADTDVAKVSVVGIGMRSHAG
VAARMFQALRDEGINIRVITTSEIKISVLIERKYMELAVQALHDAFELDRAA