Protein Info for Dshi_2039 in Dinoroseobacter shibae DFL-12

Annotation: Malate/L-lactate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF02615: Ldh_2" amino acids 12 to 328 (317 residues), 324.3 bits, see alignment E=4.5e-101

Best Hits

Swiss-Prot: 52% identical to COMC_CHRSD: (2R)-3-sulfolactate dehydrogenase (NADP(+)) (comC) from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2039)

MetaCyc: 52% identical to R-sulfolactate oxidoreductase (Chromohalobacter salexigens DSM 3043)
RXN-11690 [EC: 1.1.1.338]

Predicted SEED Role

"Ureidoglycolate dehydrogenase (EC 1.1.1.154)" in subsystem Allantoin Utilization (EC 1.1.1.154)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.154 or 1.1.1.338

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPS4 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Dshi_2039 Malate/L-lactate dehydrogenase (RefSeq) (Dinoroseobacter shibae DFL-12)
MYMSETETLSLPDARDLLFRAFTANGVPEGAARSTADALVAAEAEGQVGHGFSRLEDYVA
QARSGKIVAGAEVTITRPAPTTLLVDAGHGFAYPALERAIDEGIAVARELGTAAIAVTRS
HHCGALSIHVERAAKAGLVAMMVVNAPAAIAPWGGKTPLFGTNPIAFATPRAGSAPLVID
LSLSKVARGKVMNAKKAGKPIPEGWALDAAGNPTTDAEAALGGTMVPIGEAKGTALALMV
EILSAVMTGAALSTEAGSFFSADGPPPGVGQFLTLWRPPEGAEAFTARLAPLLAQIETME
GARLPGTRRLAALNAAQAHGIAVPRAYLDGARRLAATHP