Protein Info for Dshi_2038 in Dinoroseobacter shibae DFL-12

Annotation: Altronate dehydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF04295: GD_AH_second" amino acids 12 to 136 (125 residues), 113.3 bits, see alignment E=9.6e-37 PF20629: GD_AH_C" amino acids 146 to 390 (245 residues), 281.7 bits, see alignment E=4.6e-88

Best Hits

Swiss-Prot: 82% identical to SUYB_PARPN: (2R)-sulfolactate sulfo-lyase subunit beta (suyB) from Paracoccus pantotrophus

KEGG orthology group: K01685, altronate hydrolase [EC: 4.2.1.7] (inferred from 100% identity to dsh:Dshi_2038)

MetaCyc: 82% identical to 3-sulfolactate sulfo-lyase large subunit (Paracoccus pantotrophus NKNCYSA)
Sulfolactate sulfo-lyase. [EC: 4.4.1.24]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.7

Use Curated BLAST to search for 4.2.1.7 or 4.4.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPS3 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Dshi_2038 Altronate dehydratase (RefSeq) (Dinoroseobacter shibae DFL-12)
MASKYSNLTVKGYRRENGRVGVRNHVLILPVDDISNAACEAVANNVKGTLAIPHAYGRLQ
FGEDLELHFRTMIGTGANPNVHSVVVIGIEPGWTKRIADGIRETGKEVAEFSIEQKGDFE
TIRAASWAAKDFVHKATEMQREECSISELWVSTKCGESDTTTGLGSCPTVGNMYDKLLPE
GITGFFGETSEITGAEHICQKRAINEEVGQRWYKMWKAYQDDVIFAHQTDDLSDSQPTKG
NIEGGLTTIEEKALGNLEKIGRTSQFIDILEPAEQPKSGNGLYFMDSSSAAAECVTLMAA
GGAVIHTFPTGQGNVVGNPIVPVIKITANPRTVRTMAEHVDVDVSGILRREMTIDEAGDA
LIEMICRTANGRNTAAEALGHREFSMTKLYRSA