Protein Info for Dshi_2032 in Dinoroseobacter shibae DFL-12

Annotation: Tripartite ATP-independent periplasmic transporter DctQ component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 48 to 65 (18 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details PF04290: DctQ" amino acids 24 to 154 (131 residues), 111 bits, see alignment E=2e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2032)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPR7 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Dshi_2032 Tripartite ATP-independent periplasmic transporter DctQ component (RefSeq) (Dinoroseobacter shibae DFL-12)
MRNFLRILDKNGERWALLLFYVMLVATMFIEVLRREIMSYSSIWGEEIVRYSFIYLAWIG
CAAAVKERGHIRIDVLMQYVGRRAKALLYIFGDLVMFVVAIIALYWSFETVLVSAKFGSV
TPGLRISQVWFLMAVPTGFALVILRLVQSFLRDLADLRAGRPVYEGDKLFD