Protein Info for Dshi_2020 in Dinoroseobacter shibae DFL-12

Annotation: phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 14 to 153 (140 residues), 103.6 bits, E=1.1e-33
• PF02879: PGM_PMM_II
  • amino acids 184 to 286 (103 residues), 58.3 bits, E=1.5e-19
• PF02880: PGM_PMM_III
  • amino acids 295 to 407 (113 residues), 85.6 bits, E=4.1e-28

Best Hits

Swiss-Prot: 58% identical to PGM_RHIRD: Phosphoglucomutase (pgm) from Rhizobium radiobacter

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 100% identity to dsh:Dshi_2020)

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• chitin biosynthesis (6/9 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• sucrose biosynthesis II (4/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (1/4 steps found)
• starch degradation III (1/4 steps found)
• starch degradation V (1/4 steps found)
• glycogen degradation II (2/6 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glycogen degradation I (3/8 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (1/8 steps found)
• starch biosynthesis (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• streptomycin biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.2

Sequence Analysis Tools

See A8LPQ5 at UniProt or InterPro

Protein Sequence (543 amino acids)

>Dshi_2020 phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I (RefSeq) (Dinoroseobacter shibae DFL-12)
MPGHIVQTAPIPGQKPGTSGLRKTTREFQAPHFLENYVQAIWNGIGGVAGKTLVLGGDGR
YFNAEAAQVVLRMAAASGAARVIVGQGALLSTPAASHLIRKRGTDGGIILSASHNPGGPE
GDFGVKYNGPNGGPATEEVTDRIFAATQAITDYAMLDAQDVDLSTLGETRLGQMVVEVVD
PVADYAALMAEIFDFEAIRALLARGFRLHFDAMHAITGPYAKAILEDTLGAAPGSVVNGT
PSPDFGGGHPDPNPIWAKELVDRMMGPDAPDFGAASDGDGDRNMIMGRGIYVTPSDSLAV
LAANATRVPAYADGLAGVARSMPTSRALDRVAEALSIDCYETPTGWKFFGNLLDAGRATL
CGEESAGTGSDHVREKDGLWAVLFWLNILADSRASVADLMADHWARFGRHYYSRHDYEAV
DTAAAKGVMDALRARLADLPGTTAAGRQIAFADEFSYDDPVDGSHSAGQGLRVGFTDGAR
LVIRLSGTGTVGATLRVYLEAFVPGPEGLDRDPQEALAPMIAAAEALAEIATRTGRTAPD
VIT