Protein Info for Dshi_2013 in Dinoroseobacter shibae DFL-12

Annotation: Haloacid dehalogenase domain protein hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF13344: Hydrolase_6" amino acids 46 to 133 (88 residues), 60.2 bits, see alignment E=2.6e-20 PF00702: Hydrolase" amino acids 187 to 265 (79 residues), 29.7 bits, see alignment E=1.3e-10 PF13242: Hydrolase_like" amino acids 225 to 277 (53 residues), 42.8 bits, see alignment 5.9e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_2013)

Predicted SEED Role

"HAD superfamily protein involved in N-acetyl-glucosamine catabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LP70 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Dshi_2013 Haloacid dehalogenase domain protein hydrolase (RefSeq) (Dinoroseobacter shibae DFL-12)
MTLMTLDHAFDAYEAARPRLPRAIAPHGTPEALESLAPLADRFDAFLLDAFGVLNIGETA
IPGAVGRVADLQAAGKRVLIVSNAASVPHAALMEKYAKLGFRFAPEDVITSRRTLAHHMA
GGAAACWGVMTPEGIALDDLGPGEITVLGDDPAPYAAVDGFLLVGSAGWSAARQALLEGA
LRARPRPVLVANPDIVAPRETGLTAEPGHFAHQLADRTGVSPQFFGKPFANIYDLAFARL
GDVDRSRVVMVGDSLHTDILGAQTARVRSALITGYGFLAGRDAGAMIARSGIIPDFVVAS
P