Protein Info for Dshi_1999 in Dinoroseobacter shibae DFL-12

Annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 364 to 391 (28 residues), see Phobius details amino acids 407 to 427 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 56 to 421 (366 residues), 125.7 bits, see alignment E=9.8e-41

Best Hits

KEGG orthology group: K10544, D-xylose transport system permease protein (inferred from 100% identity to dsh:Dshi_1999)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LP56 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Dshi_1999 inner-membrane translocator (RefSeq) (Dinoroseobacter shibae DFL-12)
MSDASPTESRLPSRAKRSFLQTLELDTRLLGMIGAFVLVCLVFNLLTDGRFLTARNIFNL
SIQTVSVAIMATGMVFIIVTRHIDLAVGALLATCSAAMAMTQTAILPQVFGLELGHPAIP
WIAMLVGLVTGTVIGAFQGYLVGYLMIPAFIVTLGGLLVWRNVAWYMTNGQTIGPLDPTF
MTLGGINGTLGATLSWIVGLVAVVAACWALWSGRKNKIAHDAPVKPVWAELTVMGVVSVA
ILGFVAILNSYEVPTARLRRLFEARGEVMPEGYTEVYGIPYSVLLLIAVAVAMTVIAKKT
RFGRYIFATGGNPDAAELSGINTRMLTVKVFALMGALCAISAIVASARLTNHSNDIGTLD
ELRVIAAAVIGGTALAGGIGTIYGAILGALIMQSLQSGMAMVGVDAPLQNIVVGTVLVAA
VLIDILYRKRMGAKS