Protein Info for Dshi_1947 in Dinoroseobacter shibae DFL-12

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF00005: ABC_tran" amino acids 28 to 175 (148 residues), 113 bits, see alignment E=8.5e-37 amino acids 278 to 433 (156 residues), 44.8 bits, see alignment E=9.6e-16

Best Hits

Swiss-Prot: 44% identical to YUFO_BACSU: Uncharacterized ABC transporter ATP-binding protein YufO (yufO) from Bacillus subtilis (strain 168)

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to dsh:Dshi_1947)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LP06 at UniProt or InterPro

Protein Sequence (514 amino acids)

>Dshi_1947 ABC transporter related (RefSeq) (Dinoroseobacter shibae DFL-12)
MTETNGARPVLRLDQITKRFGALTANDAISFDLHAGEVVALLGENGAGKTTLMNILFGHY
TADEGTVEVFGQTLPPGVPRAALAAGVGMVHQHFTLADNLSVLDNVILGTVPLWRAGLGS
GAARRKLRALAEDFGLQVDPEARVGTLSVGERQRVEILKALYRDARILILDEPTAVLTPQ
EAEALFATLRRAVARGMSVIFISHKLHEVMSVAHRVVVLRHGRVVGRVATDETDRHALAE
MMVGAEITAPAPRPATPGAALMTLDRVCTDARGTATGLRDVSLTLRAGQITGLAGVSGNG
QAALADLIGGLIAPVAGALRLGNAEVADWSPRAALAQGIGRIPEDRHKTGTIADFTLTEN
AILEAYPKAQFSRSGWMRWGAAESFARDVIASYDVRCPGPETPIRLLSGGNMQKLILGRV
LEDGPRIVLANQPVRGLDIGAVTYVQEQLIAARDGGAAVLLISEDLDEVLALSDVIHVMS
EGRLSPEFARGSMTPAQLGVWMAGDGFAEDPHAA