Protein Info for Dshi_1935 in Dinoroseobacter shibae DFL-12

Annotation: cyclic nucleotide-regulated FAD-dependent pyridine nucleotide-disulphide oxidoreductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 PF00027: cNMP_binding" amino acids 31 to 115 (85 residues), 41.1 bits, see alignment E=4.2e-14 PF07992: Pyr_redox_2" amino acids 226 to 525 (300 residues), 116 bits, see alignment E=7.1e-37 PF12831: FAD_oxidored" amino acids 227 to 263 (37 residues), 28.3 bits, see alignment 3.3e-10 PF13738: Pyr_redox_3" amino acids 309 to 508 (200 residues), 57.2 bits, see alignment E=5.1e-19 PF00070: Pyr_redox" amino acids 372 to 441 (70 residues), 32.8 bits, see alignment E=2.5e-11

Best Hits

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 100% identity to dsh:Dshi_1935)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNZ4 at UniProt or InterPro

Protein Sequence (539 amino acids)

>Dshi_1935 cyclic nucleotide-regulated FAD-dependent pyridine nucleotide-disulphide oxidoreductase (RefSeq) (Dinoroseobacter shibae DFL-12)
MDTLAPDLRTMVRTPLTEAHVAAMRRIGVERAYAAGAAVTALGAAQDRFQYVLEGELEAV
DPVTGGRYGGASLGPGQFVGEISFLNDGKVMLASRACTDSVLLEVPRDAMLRLMADVPEM
SDIIVTVFAARRRRLLESQQAALTLLGADRDRQIRQIAAFASRNRIPYRSLDLDDHEAED
IAQACALLPRHPAVIFGTDTVVEDPSPRKIARLLGIDMALGADHVFDVLIVGGGPAGIAA
AVYAGAEGLSALVVEDLTIGGQAGTSSRIENYMGFPTGISGADLCWRGEVQAMKFGTRFA
VPRRAVHVAPLAAGGFCVTLDDGEEVRTRAIVIATGVQYRKLPIPRLEEFEGAGVYYAAT
DVEARYCRNTDVVVIGGGNSAGQAAMFLSRSARHVHVLIRGDGLAASMSSYLSERLDRDP
AITLHRRTQVTGLHGTDRLEEATIRDGVMGQDWTLRTGAVFVMVGAAPNTGWLDGLVTLD
DKGFVHTGPEVGGRSTYETSCPGIFAVGDVRAGSVKRVASGVGEGSVVISKVWEHVNAP