Protein Info for Dshi_1932 in Dinoroseobacter shibae DFL-12

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF02798: GST_N" amino acids 46 to 127 (82 residues), 29.1 bits, see alignment E=2.1e-10 PF13409: GST_N_2" amino acids 66 to 127 (62 residues), 25.5 bits, see alignment E=3.3e-09 PF13410: GST_C_2" amino acids 176 to 244 (69 residues), 26.9 bits, see alignment E=8.3e-10 PF00043: GST_C" amino acids 181 to 249 (69 residues), 21.8 bits, see alignment E=3.6e-08

Best Hits

Swiss-Prot: 68% identical to YGHU_ECOLI: Disulfide-bond oxidoreductase YghU (yghU) from Escherichia coli (strain K12)

KEGG orthology group: K11209, GST-like protein (inferred from 100% identity to dsh:Dshi_1932)

MetaCyc: 68% identical to disulfide reductase / organic hydroperoxide reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6256

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNZ1 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Dshi_1932 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTEPTYTPPAVWTWETESGGKFASINRPVAGPTHDKALPVGEHGLQLYSLATPNGVKVTV
LLEELLAAGHTGAEYDAWLIRINDGDQFGSGFVEVNPNSKIPALMDRTGETPVRVFESGA
ILLHLAEKFGAFLTGPEARAEMLSWLFWQMGSAPYLGGGFGHFYAYAPEKMEYPINRFAM
ETKRQLDVLDRHLAERDWMAGGVYTIADMAIWAWYGQLVLGRLYEAAEFLDVTSYTHVLD
WAQRIDARPAVQRGRMVNRTFGDPAMQLHERHSAADFDTMTEDKRAAAG