Protein Info for Dshi_1927 in Dinoroseobacter shibae DFL-12
Annotation: putative transaldolase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to TAL_DINSH: Probable transaldolase (tal) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to dsh:Dshi_1927)MetaCyc: 33% identical to fructose-6-phosphate aldolase 1 (Escherichia coli K-12 substr. MG1655)
4.1.2.-
Predicted SEED Role
"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)
MetaCyc Pathways
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- superpathway of glucose and xylose degradation (14/17 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (8/9 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- pentose phosphate pathway (7/8 steps found)
- Bifidobacterium shunt (12/15 steps found)
- Rubisco shunt (8/10 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Pentose phosphate pathway
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.2.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LNY7 at UniProt or InterPro
Protein Sequence (217 amino acids)
>Dshi_1927 putative transaldolase (RefSeq) (Dinoroseobacter shibae DFL-12) MKFFVDTADVAAIAELNDLGMVDGVTTNPSLILKSGRDITEVTKEICELVDGPVSAEVVA TQADAMIAEGRKLAEIAENITVKLPLTWDGLKACKTLTDEGKMVNVTLCFSANQALLAAK AGASFISPFIGRLDDLNVDGMELIEDIRTIYDNYGYETEILAASIRTVNHMKEAALIGAD VATAPPGVIKQMANHVLTDKGLAAFLSDWEKTGQKIL