Protein Info for Dshi_1886 in Dinoroseobacter shibae DFL-12

Annotation: exodeoxyribonuclease III Xth (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00195: exodeoxyribonuclease III" amino acids 1 to 256 (256 residues), 239.4 bits, see alignment E=4.9e-75 TIGR00633: exodeoxyribonuclease III (xth)" amino acids 1 to 257 (257 residues), 225 bits, see alignment E=1.1e-70 PF03372: Exo_endo_phos" amino acids 4 to 250 (247 residues), 122.6 bits, see alignment E=1e-39

Best Hits

KEGG orthology group: K01142, exodeoxyribonuclease III [EC: 3.1.11.2] (inferred from 100% identity to dsh:Dshi_1886)

Predicted SEED Role

"Exodeoxyribonuclease III (EC 3.1.11.2)" in subsystem DNA repair, bacterial (EC 3.1.11.2)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.2

Use Curated BLAST to search for 3.1.11.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNB5 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Dshi_1886 exodeoxyribonuclease III Xth (RefSeq) (Dinoroseobacter shibae DFL-12)
MQIATFNINGIKARINALPDWLREASPDVVVLQEIKSVDAAFPRELFEDMGYTVETHGQK
SFNGVAILSKLPLEDVTRGLPGDDGDEQARWIEATVMGDVPVRVCGLYLPNGNPAPGPKY
DYKLAWMARLKTRAAELLAAEEPALMAGDYNIIPLDEDAARPEAWRKDALALPASRAAFR
EILNLGFTDAFRTRVPGPGHYSFWDYQAGAWQRNDGIRIDHILMTPDCADLMRDCRIDAA
VRGGEKPSDHVPVVVDLAA