Protein Info for Dshi_1857 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF81 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 14 to 39 (26 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 134 to 161 (28 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details PF01925: TauE" amino acids 18 to 243 (226 residues), 69.3 bits, see alignment E=2.1e-23

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to dsh:Dshi_1857)

Predicted SEED Role

"Bll0704 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN86 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Dshi_1857 protein of unknown function DUF81 (RefSeq) (Dinoroseobacter shibae DFL-12)
MPDLLLAGWEIPGLGWIMAISVLAGLVYGFAGFGSALIFMPLATLFLAPPLAVGAFSLSS
LASLVTLVPDALRVADLRATGVMLATALLALFPGVWLLTSLPVMWLEWAVSLTVLGTLVA
LIAGWRYTRPPGVPAWIGVGAGVGVIGGATGLNGPVVVLFQLGGQDSAVRSRANTVIVLT
FSSLAMLPVMALQGAMPAGAISLGLWLVPAYAVGTLIGRALFTPARGRLYRTVAYVIIGA
AGLLGLPISF