Protein Info for Dshi_1850 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF1223 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF06764: DUF1223" amino acids 30 to 220 (191 residues), 221.8 bits, see alignment E=4.9e-70

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1850)

Predicted SEED Role

"hypothetical protein that often co-occurs with aconitase" in subsystem TCA Cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN79 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Dshi_1850 protein of unknown function DUF1223 (RefSeq) (Dinoroseobacter shibae DFL-12)
MRILGTLFALWAAASVVTAPAASADEKTVVVELFTSQGCSSCPPADALLAELDKSADVIA
LALHVDYWDYIGWKDSFADPENTERQRGYARAAKARSIFTPQMVIGGVDHVIGYKPMDVA
NTVQKHRAAPDGATVSARLNGDTVIIRLSPGDARGAMTVSLVGYVPKETVKIKRGENAGK
TITYTNTVREFVSLGTWDGRAQKDLRHPKPAGEAAVVLVQKASHGPMVAAARVE