Protein Info for Dshi_1840 in Dinoroseobacter shibae DFL-12

Annotation: OsmC family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 PF12697: Abhydrolase_6" amino acids 32 to 239 (208 residues), 33.6 bits, see alignment E=1.6e-11 PF00561: Abhydrolase_1" amino acids 32 to 200 (169 residues), 27.2 bits, see alignment E=7.5e-10 PF12146: Hydrolase_4" amino acids 48 to 151 (104 residues), 46.5 bits, see alignment E=7.4e-16 PF00326: Peptidase_S9" amino acids 49 to 252 (204 residues), 29.5 bits, see alignment E=1.3e-10 PF02566: OsmC" amino acids 299 to 399 (101 residues), 68.6 bits, see alignment E=1.4e-22

Best Hits

KEGG orthology group: K06889, (no description) K07397, putative redox protein (inferred from 100% identity to dsh:Dshi_1840)

Predicted SEED Role

"OsmC-like family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN69 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Dshi_1840 OsmC family protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MPTEKLTFTGHSGDTLAARLDLPEGPHLATALFAHCFTCSKDIPAARRIAQRLAAMGIAV
LRFDFTGLGHSGGEFRNTTFSSNVADLRLAAEALAARGMAPSLLIGHSLGGAAVLKAVRS
IPGVKAVATIGAPFDPGHVTHNFAEALETIAAQGEAEVQLGGRPFRIRKAFVEDVTAEKL
APEIAAMKAALLVLHAPLDAQVGIENATQIFAAAKHPKSFVTLDDADHLITRAADADYAA
EVIAAWVGRYLDLRPPAPPPGVPEGITRVSEADPAGFLQDVSAGPSHHIQADEPLAYGGT
NRGLTPYQLLAAGLGACTSMTLRMYARQKGWPLTHVSVDVMHDKVHGQDAKGAHDRIDSF
VRRIHLEGDLDTAQQERLLEIADKCPVHRTLETGARIVTELAVPA