Protein Info for Dshi_1827 in Dinoroseobacter shibae DFL-12

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 22 to 39 (18 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 70 to 95 (26 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 163 to 187 (25 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 262 to 287 (26 residues), see Phobius details amino acids 290 to 290 (1 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 24 to 325 (302 residues), 218 bits, see alignment E=7.1e-69

Best Hits

Swiss-Prot: 66% identical to TAUZ_PARDE: UPF0324 membrane protein TauZ (tauZ) from Paracoccus denitrificans

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1827)

Predicted SEED Role

"Probable sulfate exporter tauZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN56 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Dshi_1827 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MSTTSESSPTLAGRTTGFLTENGPGFAVSVVIAVCAQFLSDHYGAPAMLMALLLGIAFHF
LAEEGRCVPGIAFTSKTVLRIGVALLGARISVELLIGLGPKLIGLVVAGVILTILFGLLG
AKLLGRGWRFALLTGGAVAICGASAAMAIAAVLPKNEHSERNLIFTVLSVTILSTIAMIA
YPVITAWLDLDDLAAGVFLGGTIHDVAQVVGAGFSVSNETGETATLVKLIRVTMLAPVVL
VFALAIRAFAEDAPGQGGKRPPLMPFFVIMFLVLAAINSFGLIPAVLQTFLADLSKWALL
VSIAAVGMKTSLRTIFDVGGQAIILIVAQTVFIAAFILYGITHFAS