Protein Info for Dshi_1822 in Dinoroseobacter shibae DFL-12

Annotation: arsenical-resistance protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 76 to 101 (26 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details TIGR00832: arsenical-resistance protein" amino acids 1 to 330 (330 residues), 393 bits, see alignment E=6e-122 PF01758: SBF" amino acids 47 to 242 (196 residues), 125.6 bits, see alignment E=2.1e-40 PF13593: SBF_like" amino acids 88 to 316 (229 residues), 37.2 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: K03325, arsenite transporter, ACR3 family (inferred from 100% identity to dsh:Dshi_1822)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LML9 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Dshi_1822 arsenical-resistance protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MGRFERYLSVWVALAIGAGLVLGSVVPGVFAGLAALEVASVNLPVAVLIWAMVFPMMVGV
DFGALGGVATRPKGLVITLVVNWLVKPFTMAALGVLFFNHVFAPFIPPEDAQMYLAGVIL
LGAAPCTAMVFVWSNMTKGDPNYTLVQVSVNDVVLVFAFAPIVALLLGVTDIVVPWETLL
LSVALYVVIPLAVGVVVRKRLLDGGGAEALAAFQARVKPASVAGLLLTVVLLFGFQGRVI
LETPLVIAMIAVPLLIQSYGVFFVAYYAAKAWRVPHEVAAPCALIGTSNFFELAVAVAIS
VFGLGSGAALATVVGVLVEVPVMLSLVAFANRTRGWFPKSP