Protein Info for Dshi_1821 in Dinoroseobacter shibae DFL-12

Annotation: glycosyltransferase involved in cell wall biogenesis (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 44% identical to GPGS_PERMH: Glucosyl-3-phosphoglycerate synthase (gpgS) from Persephonella marina (strain DSM 14350 / EX-H1)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1821)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

See A8LML8 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Dshi_1821 glycosyltransferase involved in cell wall biogenesis (RefSeq) (Dinoroseobacter shibae DFL-12)
MHEAGATGVADFHQNGNITTLHNLRTRSVEELTQELKAYSVSRKISLILPSLYSELEGPA
LPRILDELSEVPYLHRIIIGLDRADEAQYRHARDFFGRLPQDHIVIWNDSPRMTGLGRRL
ETMGLAPQEAGKGKNVWSCLGYLMACQDSAVMAIHDCDILTYDRDMLARLVYPVVNPNFP
YQVAKGYYPRIGENRINGRVTRLLVSPLLIALKRVIGDRDYIDYLRSFRYPLSGEFAMRT
GILPDLRIPSDWGLEIGVLSEAWRNLAPKAVCQVEISDAYDHKHQDLSEDDASAGLSRMS
TDICKSIFRKLAMDGTVFTTHVFRTLKATYYRSALDLLEAYYSDAMMNGLAIDRHREEQS
IELFAENIMRAGQIFLDNPSETPFIPTWNRVHAADPDFLSDFRRAAAEDVAEYGAG