Protein Info for Dshi_1813 in Dinoroseobacter shibae DFL-12

Annotation: major facilitator superfamily MFS_1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 237 (227 residues), 49.5 bits, see alignment E=3.1e-17 amino acids 205 to 381 (177 residues), 67.5 bits, see alignment E=1e-22 PF00083: Sugar_tr" amino acids 39 to 158 (120 residues), 22.6 bits, see alignment E=4.6e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_1813)

Predicted SEED Role

"Transporter, Major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LML0 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Dshi_1813 major facilitator superfamily MFS_1 (RefSeq) (Dinoroseobacter shibae DFL-12)
MLSVFRSSWALLLGVLLLMTGNGILATILGVRGAIEGFSTFEMSLVMTGYFVGFLGGSSA
APEMIRRVGHVRVFAALGSFISAALILFPVFTDPYIWSLLRILVGFCFAGVYVTAESWLN
NASTNENRGSAMAIYGVVLTGGIVVAQWMVSQGDASGYIMFILPSILISISFAPILLSIS
PAPPYEAGAPMSFRQVFNVSPLGLVGMTLMGGVYSALFGMASVYGTEVGLSIGQLSTFIA
TLYLGGLVLQFPVGWISDRMDRRLLICVLAGMGAVGAILAGFGLGGYPGLIASSFLIGGA
ANPLYGLLIAYTNDYLEPSDMSAAAGRLVFSNGLGAVAGPVFTGWLMSQVGPAGFFLFVF
GLMASLCAYALYRMTRRASVSVEDSGAYQPITPGASPVSVAVAQEAAVEAAEEAAEEAAE
EASGTQTAA