Protein Info for Dshi_1803 in Dinoroseobacter shibae DFL-12

Annotation: transcriptional repressor, LexA family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 TIGR00498: repressor LexA" amino acids 2 to 230 (229 residues), 176.4 bits, see alignment E=2.8e-56 PF01726: LexA_DNA_bind" amino acids 2 to 63 (62 residues), 55.7 bits, see alignment E=3.4e-19 PF00717: Peptidase_S24" amino acids 109 to 225 (117 residues), 113.9 bits, see alignment E=3.4e-37

Best Hits

Swiss-Prot: 100% identical to LEXA_DINSH: LexA repressor (lexA) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 100% identity to dsh:Dshi_1803)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LMK0 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Dshi_1803 transcriptional repressor, LexA family (RefSeq) (Dinoroseobacter shibae DFL-12)
MLTRKQIELLEFIHKRLQRDGVPPSFDEMKDALDLRSKSGIHRLITALEERGFIRRLAHK
ARAIEIVKLPEALMGSMQGGFAPQVIDGDRLDPPVGAMPVSGIHAVELPVMGKIAAGTPI
EAISEVSHTVAVPGQMMRQDAEHYALEVKGDSMINAGINNGDIVVIRETSVAESGDIVVA
LVDGHEATLKTLRKRGNAIALEAANPAYETRVYPAEMVRVQGKLVGLIRSY