Protein Info for Dshi_1739 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF808 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 75 to 103 (29 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 281 to 306 (26 residues), see Phobius details PF05661: DUF808" amino acids 2 to 303 (302 residues), 406.7 bits, see alignment E=2.7e-126

Best Hits

KEGG orthology group: K09781, hypothetical protein (inferred from 100% identity to dsh:Dshi_1739)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LMD6 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Dshi_1739 protein of unknown function DUF808 (RefSeq) (Dinoroseobacter shibae DFL-12)
MSGLIALLDDVAALAKVAAASLDDVVGQATKAGAKAAGAVIDDAAVTPKYVQGFEAAREL
PIVWRIAKGSIRNKLVILLPVALLLSAFAPWLIPLLLMLGGAYLCFEGAEKILHVFHAKK
SHEPVAVEEKVTSARLEEAKVAGAIKTDFILSAEIMTIALAALPATGGVMLQIPALALVA
LGITALVYGSVAVIVKADDVGLHMAQAGRLASTRALGRGIVTSMPTFLKLLTVVGTAAML
WVGGSIILHGLEEMGVAGPAHAIHAIAEAVAHTVSAAQGAIGWLVTATLDGVFGLILGLV
IVPLVTRASALIPRG