Protein Info for Dshi_1732 in Dinoroseobacter shibae DFL-12

Annotation: modification methylase, HemK family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 52 to 269 (218 residues), 253.6 bits, see alignment E=2e-79 TIGR00536: methyltransferase, HemK family" amino acids 53 to 271 (219 residues), 185 bits, see alignment E=1.6e-58 PF05175: MTS" amino acids 95 to 187 (93 residues), 57.6 bits, see alignment E=4.4e-19 PF06325: PrmA" amino acids 105 to 180 (76 residues), 25.3 bits, see alignment E=3.7e-09 PF13847: Methyltransf_31" amino acids 108 to 234 (127 residues), 52 bits, see alignment E=2.4e-17 PF13649: Methyltransf_25" amino acids 110 to 180 (71 residues), 40.1 bits, see alignment E=1.7e-13 PF08241: Methyltransf_11" amino acids 111 to 180 (70 residues), 26 bits, see alignment E=4.1e-09 PF08242: Methyltransf_12" amino acids 111 to 180 (70 residues), 32.8 bits, see alignment E=3.3e-11 PF01170: UPF0020" amino acids 128 to 186 (59 residues), 25.5 bits, see alignment E=3.6e-09

Best Hits

Swiss-Prot: 41% identical to PRMC_CHLTE: Release factor glutamine methyltransferase (prmC) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to dsh:Dshi_1732)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLU6 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Dshi_1732 modification methylase, HemK family (RefSeq) (Dinoroseobacter shibae DFL-12)
MSDRHAAWLQALAEAGVADPAGDLRRLFDWAYAQGQGDPAPQTRDRPNDWTLYTLEDAVK
ARAARQPVSQIIGRRAFFKHDFEVTPDVLDPRPDTETLVEVALAHPFDTVLDIGSGSGCI
LLSLLAERPEATGLGIDISAPALDVARRNADRLGLAGRARFRRSDWLAEVDEQFDLIVSN
PPYIDAATYATLAPELRDWEPRGALEAGADGLDAYRVIARDAPRVLAPGGTLCLEIGHDQ
GRSVPALLAASGWRQITVQRDLIGKDRVVTANLI