Protein Info for Dshi_1720 in Dinoroseobacter shibae DFL-12

Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 4 to 324 (321 residues), 405.1 bits, see alignment E=9.8e-126 PF00108: Thiolase_N" amino acids 49 to 147 (99 residues), 38.2 bits, see alignment E=1.7e-13 PF08545: ACP_syn_III" amino acids 108 to 191 (84 residues), 104.2 bits, see alignment E=4e-34 PF08541: ACP_syn_III_C" amino acids 235 to 324 (90 residues), 124.4 bits, see alignment E=2.5e-40

Best Hits

Swiss-Prot: 100% identical to FABH_DINSH: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to dsh:Dshi_1720)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.41)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.3.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.41

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLT4 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Dshi_1720 3-oxoacyl-(acyl-carrier-protein) synthase III (RefSeq) (Dinoroseobacter shibae DFL-12)
MGKRAVVTGVGHYLPSRVVPNSELETLVDTTDEWIRTRSGIERRHFAADGEQTSDLATAA
AQAALDHAELTAQDVDAVIVATSTPDLTFPAVATMVQARLGMTRGFAYDVQAVCAGFVFA
MANANAMILSGQADRILVIGAETFSRIMDWTDRSTCVLFGDGAGAVVLEARDGTGGTADR
GILSADLNSDGRHRDILYVDGGVSSSQTAGYLRMEGKEVFRHAIEKLAATAETALAKAGL
TEADVDWVVPHQANLRIITATARKMGIGMDRVVVTVADHGNTSAASIPMALSVGVARGQI
KPGDLVVTEAIGGGLSWGSVVLRW