Protein Info for Dshi_1720 in Dinoroseobacter shibae DFL-12
Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase III (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to FABH_DINSH: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to dsh:Dshi_1720)Predicted SEED Role
"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.41)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.3.1.41)
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
- superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
- superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
- oleate biosynthesis IV (anaerobic) (13/14 steps found)
- (5Z)-dodecenoate biosynthesis I (6/6 steps found)
- palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
- superpathway of fatty acid biosynthesis initiation (5/5 steps found)
- gondoate biosynthesis (anaerobic) (4/4 steps found)
- fatty acid biosynthesis initiation (type II) (3/3 steps found)
- (5Z)-dodecenoate biosynthesis II (5/6 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- fatty acid elongation -- saturated (4/5 steps found)
- octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
- palmitate biosynthesis III (21/29 steps found)
- fatty acid biosynthesis initiation (mitochondria) (3/4 steps found)
- 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
- stearate biosynthesis IV (4/6 steps found)
- tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
- biotin biosynthesis I (8/15 steps found)
- streptorubin B biosynthesis (20/34 steps found)
- mycolate biosynthesis (21/205 steps found)
- superpathway of mycolate biosynthesis (22/239 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.41
Use Curated BLAST to search for 2.3.1.180 or 2.3.1.41
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LLT4 at UniProt or InterPro
Protein Sequence (324 amino acids)
>Dshi_1720 3-oxoacyl-(acyl-carrier-protein) synthase III (RefSeq) (Dinoroseobacter shibae DFL-12) MGKRAVVTGVGHYLPSRVVPNSELETLVDTTDEWIRTRSGIERRHFAADGEQTSDLATAA AQAALDHAELTAQDVDAVIVATSTPDLTFPAVATMVQARLGMTRGFAYDVQAVCAGFVFA MANANAMILSGQADRILVIGAETFSRIMDWTDRSTCVLFGDGAGAVVLEARDGTGGTADR GILSADLNSDGRHRDILYVDGGVSSSQTAGYLRMEGKEVFRHAIEKLAATAETALAKAGL TEADVDWVVPHQANLRIITATARKMGIGMDRVVVTVADHGNTSAASIPMALSVGVARGQI KPGDLVVTEAIGGGLSWGSVVLRW